A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2X5/P2RX5. Source: E.coli Amino Acid Sequence: TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE The P2X5/P2RX5 Recombinant Protein Antigen is derived from E. coli. The P2X5/P2RX5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Gene ID (Entrez) : 5026
Méthode de purification : >80% by SDS-PAGE and Coomassie blue staining
Nom usuel : P2X5/P2RX5 Recombinant Protein Antigen
Contenu et stockage : Store at −20°C. Avoid freeze-thaw cycles.
Formule : PBS and 1M Urea, pH 7.4.
À utiliser avec (application) : Blocking/Neutralizing, Control
Alias de gène : ATP receptor, ATP receptor subunit, ionotropic ATP receptor P2X5, LRH-1, MGC47755, P2X purinoceptor 5, P2X5lymphoid-restricted histocompatibility antigen-1, P2X5R, Purinergic receptor, purinergic receptor P2X ligand gated ion channel 5, purinergic recepto
Symbole de gène(s) : P2RX5
Type d’étiquette : Unlabeled
Type de produit : Recombinant Protein Antigen
Quantité : 100μL
État réglementaire : RUO
Catégorie de recherche : Signal Transduction
Source : E.Coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53058. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
