A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P2X5/P2RX5.
Points forts
Amino Acid Sequence
TNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTGRCLRRENLARGTCEIFAWCPLETSSRPEEPFLKE The P2X5/P2RX5 Recombinant Protein Antigen is derived from E. coli. The P2X5/P2RX5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-154860 |
|---|
| Réf. fabricant | 18295444 |
|---|
| Gene ID (Entrez) | 5026 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | P2X5/P2RX5 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | ATP receptor, ATP receptor subunit, ionotropic ATP receptor P2X5, LRH-1, MGC47755, P2X purinoceptor 5, P2X5lymphoid-restricted histocompatibility antigen-1, P2X5R, Purinergic receptor, purinergic receptor P2X ligand gated ion channel 5, purinergic recepto |
|---|
| Symbole de gène(s) | P2RX5 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Catégorie de recherche | Signal Transduction |
|---|
| Source | E.Coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53058. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
