Novus Biologicals™ Proteasome 20S alpha 5 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
This is a blocking peptide for NBP1-86838. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Gene ID (Entrez) : 5686
Espèces : Human
Méthode de purification : Chromatography
Pureté : >80%
Concentration : 0.5mg/mL
Contenu et stockage : Store at -20°C. Avoid freeze-thaw cycles.
Formule : PBS and 1M Urea, pH 7.4.
À utiliser avec (application) : Blocking/Neutralizing, Control
Symbole de gène(s) : PSMA5
Type d’étiquette : Unlabeled
Poids moléculaire : 26kDa
Type de produit : Proteasome 20S alpha 5
Quantité : 0.1mL
État réglementaire : RUO
Source : E.Coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86838. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogène : ARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI