Novus Biologicals™ LYPD5 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
This is a blocking peptide for NBP1-83549. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Gene ID (Entrez) : 284348
Espèces : Human
Méthode de purification : Chromatography
Pureté : >80%
Concentration : 0.5mg/mL
Contenu et stockage : Store at -20°C. Avoid freeze-thaw cycles.
Formule : PBS and 1M Urea, pH 7.4.
À utiliser avec (application) : Blocking/Neutralizing, Control
Symbole de gène(s) : LYPD5
Type d’étiquette : Unlabeled
Poids moléculaire : 26kDa
Type de produit : LYPD5
Quantité : 0.1mL
État réglementaire : RUO
Source : E.Coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83549. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogène : SRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGTTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSASA