Novus Biologicals™ SPATA13 Recombinant Protein Antigen

Ref : 18267549
242.97

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Gene ID (Entrez) :
221178
Espèces :
Human
Méthode de purification :
Chromatography
Pureté :
>80%
Concentration :
0.5mg/mL
Contenu et stockage :
Store at -20°C. Avoid freeze-thaw cycles.
Brand
Novus Biologicals™

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SPATA13. The SPATA13 Recombinant Protein Antigen is derived from E. coli. The SPATA13 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-90848. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Gene ID (Entrez) : 221178


Espèces : Human


Méthode de purification : Chromatography


Pureté : >80%


Concentration : 0.5mg/mL


Contenu et stockage : Store at -20°C. Avoid freeze-thaw cycles.


Formule : PBS and 1M Urea, pH 7.4.


À utiliser avec (application) : Blocking/Neutralizing, Control


Symbole de gène(s) : SPATA13


Type d’étiquette : Unlabeled


Poids moléculaire : 26kDa


Type de produit : SPATA13


Quantité : 0.1mL


État réglementaire : RUO


Source : E.Coli


Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90848. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml


Immunogène : NQKKLAMLNAQKAGHGKSKGYNRCPVAPPHQGLHPIHQRHITMPTSVPQQQVFGLAEPKRKSSLFWHTFNRLT