Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
<b>Applications:</b> Flow Cytometry, In vitro assay
Generated SQL Query: SELECT b.id, b.name, b.categoryId, b.subCategoryId FROM brand b GROUP BY b.id LIMIT 15
<b>Applications:</b> Flow Cytometry, In vitro assay
TLR2 / TLR4 Inhibitor Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKKPGFLRDPWCKYQML (Inhibitor sequence: PGFLRDPWCKYQML); Molecular weight: 4097.92 Da ; Antennapedia Control Peptide: 1mg (lyophilized); sequence: DRQIKIWFQNRRMKWKK; Molecular weight: 2361 Da
Couleur : White
Contenu et stockage : Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
À utiliser avec (application) : Inhibit TLR2 and TLR4 signaling
Type de produit : TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Quantité : 5 mg