Novus Biologicals™ SCA31 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. <b>Applications:</b> Antibody Competition
Generated SQL Query: SELECT b.id, b.name, b.categoryId, b.subCategoryId FROM brand b GROUP BY b.id LIMIT 15
Highly purified. Generating reliable and reproducible results. <b>Applications:</b> Antibody Competition
This is a blocking peptide for NBP2-30872. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Gene ID (Entrez) : 146227
Espèces : Human
Méthode de purification : Chromatography
Pureté : >80%
Concentration : 0.5mg/mL
Contenu et stockage : Store at -20°C. Avoid freeze-thaw cycles.
Formule : PBS and 1M Urea, pH 7.4.
À utiliser avec (application) : Blocking/Neutralizing, Control
Symbole de gène(s) : BEAN1
Type d’étiquette : Unlabeled
Poids moléculaire : 23kDa
Type de produit : SCA31
Quantité : 0.1mL
État réglementaire : RUO
Source : E.Coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30872. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogène : RHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGD