A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NACA1. Source: E.coli Amino Acid Sequence: SQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEV The NACA1 Recombinant Protein Antigen is derived from E. coli. The NACA1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
- Gene ID (Entrez)
- 4666
- Méthode de purification
- >80% by SDS-PAGE and Coomassie blue staining
- Nom usuel
- NACA1 Recombinant Protein Antigen
- Contenu et stockage
- Store at −20°C. Avoid freeze-thaw cycles
- Formule
- PBS and 1M Urea, pH 7.4
- À utiliser avec (application)
- Blocking/Neutralizing, Control
- Alias de gène
- Allergen Hom s 2, Alpha-NAC, MGC117224, NACA1, NAC-alpha, nascent polypeptide-associated complex alpha subunit, nascent polypeptide-associated complex subunit alpha, nascent-polypeptide-associated complex alpha polypeptide
- Symbole de gène(s)
- NACA
- Type d’étiquette
- Unlabeled
- Type de produit
- Recombinant Protein Antigen
- Quantité
- 100μL
- État réglementaire
- RUO
- Catégorie de recherche
- DNA replication Transcription Translation and Splicing
- Source
- E.coli
- Réactivité spécifique
- This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
