A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ING1. Source: E.coli Amino Acid Sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK The ING1 Recombinant Protein Antigen is derived from E. coli. The ING1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Gene ID (Entrez) : 3621
Méthode de purification : >80% by SDS-PAGE and Coomassie blue staining
Nom usuel : ING1 Recombinant Protein Antigen
Contenu et stockage : Store at −20°C. Avoid freeze-thaw cycles.
Formule : PBS and 1M Urea, pH 7.4.
À utiliser avec (application) : Blocking/Neutralizing, Control
Alias de gène : growth inhibitor ING1, growth inhibitory protein ING1, inhibitor of growth family, member 1, inhibitor of growth protein 1, p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a, tumor suppressor ING1
Symbole de gène(s) : ING1
Type d’étiquette : Unlabeled
Type de produit : Recombinant Protein Antigen
Quantité : 100μL
État réglementaire : RUO
Source : E.coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51784. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
