A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ING1. Source: E.coli Amino Acid Sequence: VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK The ING1 Recombinant Protein Antigen is derived from E. coli. The ING1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
- Gene ID (Entrez)
- 3621
- Méthode de purification
- >80% by SDS-PAGE and Coomassie blue staining
- Nom usuel
- ING1 Recombinant Protein Antigen
- Contenu et stockage
- Store at −20°C. Avoid freeze-thaw cycles.
- Formule
- PBS and 1M Urea, pH 7.4.
- À utiliser avec (application)
- Blocking/Neutralizing, Control
- Alias de gène
- growth inhibitor ING1, growth inhibitory protein ING1, inhibitor of growth family, member 1, inhibitor of growth protein 1, p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a, tumor suppressor ING1
- Symbole de gène(s)
- ING1
- Type d’étiquette
- Unlabeled
- Type de produit
- Recombinant Protein Antigen
- Quantité
- 100μL
- État réglementaire
- RUO
- Source
- E.coli
- Réactivité spécifique
- This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51784. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
