A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TAB3. The NAP1 Recombinant Protein Antigen is derived from E. coli. The NAP1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP2-33985. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Caractéristiques techniques
| Réf. B-LABO | BL-RE-047708 |
|---|
| Réf. fabricant | 18156752 |
|---|
| Gene ID (Entrez) | 257397 |
|---|
| Méthode de purification | Chromatography |
|---|
| Concentration | 0.5mg/mL |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| Alias de gène | CG5330, Dmel\CG5330, dNap, dNAP1, dNAP-1, MAP3K7IP3, MGC45404, mitogen-activated protein kinase kinase kinase 7 interacting protein 3, Mitogen-activated protein kinase kinase kinase 7-interacting protein 3, NAP1, NAP-1, NF-kappa-B-activating protein 1, NFkB activating protein 1, p56/dCAF-4, TAB-3, TAK1-binding protein 3, TGF-beta activated kinase 1/MAP3K7 binding protein 3, TGF-beta-activated kinase 1 and MAP3K7-binding protein 3, TGF-beta-activated kinase 1-binding protein 3 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | NAP1 |
|---|
| État réglementaire | RUO |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33985. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
| Espèces | Human |
|---|
| Pureté | >80% |
|---|
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Symbole de gène(s) | TAB3 |
|---|
| Poids moléculaire | 26kDa |
|---|
| Quantité | 0.1mL |
|---|
| Source | E.Coli |
|---|
| Immunogène | RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
