A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ODR4/TTG1.
Points forts
Amino Acid Sequence
FCRTYDIHDPKSSARPADWKYQSGLSSSWLSLECTVHINIHIPLSATSVSYTLEKNTKNGLTRWAKEIENGVYLINGQVKDEDCDLLEGQKKSSRGNTQATSHCFDVRVLTQLLLNSDHRS The ODR4/TTG1 Recombinant Protein Antigen is derived from E. coli. The ODR4/TTG1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-103830 |
|---|
| Réf. fabricant | 18216475 |
|---|
| Gene ID (Entrez) | 54953 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | ODR4/TTG1 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | chromosome 1 open reading frame 27, FLJ20505, hODR-4, LAG1-interacting protein, odorant response abnormal 4, odr-4, ODR4, protein odr-4 homolog, Transactivated by transforming growth factor beta protein 1, TTG1, TTG1A |
|---|
| Symbole de gène(s) | ODR4 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51212. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
