A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Lipin 3.
Points forts
Amino Acid Sequence
LIQELIKNHKSTYERLGEVVELLFPPVARGPSTDLANPEYSNFCYWREPLPAVDLDT The Lipin 3 Recombinant Protein Antigen is derived from E. coli. The Lipin 3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-104036 |
|---|
| Réf. fabricant | 18289763 |
|---|
| Gene ID (Entrez) | 64900 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | Lipin 3 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | dJ450M14.2, dJ450M14.3, dJ620E11.2, EC 3.1.3.4, lipin 3, lipin 3-like, lipin-3, Lipin-3-like, LIPN3L, phosphatidate phosphatase LPIN3, SMP2 |
|---|
| Symbole de gène(s) | LPIN3 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53224. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
