Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A blocking peptide from human MTR.
Synthetic
(Accession #: NP_000245) GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL. The MTR Blocking Peptide is derived from Synthetic. The MTR Blocking Peptide has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-104783 |
| Réf. fabricant | 18246638 |
| Gene ID (Entrez) | 4548 |
| Espèces | Human |
| Numéro d’adhésion | Q99707 |
| Contenu et stockage | Store at -20 C. Avoid freeze-thaw cycles. |
| Formule | Lyophilized from sterile distilled water. |
| À utiliser avec (application) | This Peptide is Useful as a Blocking Peptide for NBP1-79285. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here . |
| Alias de gène | 5-methyltetrahydrofolate-homocysteine methyltransferase, 5-methyltetrahydrofolate-homocysteine methyltransferase 1, cblG, cobalamin-dependent methionine synthase, EC 2.1.1.13, FLJ33168, FLJ43216,5-methyltetrahydrofolate--homocysteine methyltransferase, FLJ45386, methionine synthase, MS, Vitamin-B12 dependent methionine synthase |
| Symbole de gène(s) | MTR |
| Poids moléculaire | 140kDa |
| Type de produit | MTR |
| Quantité | 100 μg |
| État réglementaire | RUO - research use only |
| Consigne | Synthetic peptide from the C terminal of human MTR Peptide sequence GSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRL |
