Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF638. The ZNF638 Recombinant Protein Antigen is derived from E. coli. The ZNF638 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-82730. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-105101 |
| Réf. fabricant | 18706223 |
| Gene ID (Entrez) | 27332 |
| Concentration | 0.5mg/mL |
| Formule | PBS and 1M Urea, pH 7.4. |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 27kDa |
| État réglementaire | RUO |
| Immunogène | GLLKPTSARSGLAESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIMKRDDSNNKTLAEQNTKNPK |
