A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGFR1OP2. The FGFR1OP2 Recombinant Protein Antigen is derived from E. coli. The FGFR1OP2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
- Gene ID (Entrez)
- 26127
- Espèces
- Human
- Méthode de purification
- Chromatography
- Pureté
- >80%
- Concentration
- 0.5mg/mL
- Contenu et stockage
- Store at -20°C. Avoid freeze-thaw cycles.
- Formule
- PBS and 1M Urea, pH 7.4.
- À utiliser avec (application)
- Blocking/Neutralizing, Control
- Symbole de gène(s)
- FGFR1OP2
- Type d’étiquette
- Unlabeled
- Poids moléculaire
- 28kDa
- Type de produit
- FGFR1OP2
- Quantité
- 0.1mL
- État réglementaire
- RUO
- Source
- E.Coli
- Réactivité spécifique
- This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84148. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
- Immunogène
- ADAKALVERLRDHDDAAESLIEQTTALNKRVEAMKQYQEEIQELNEVARHRPRSTLVMGIQQENRQIRELQQENKELRTSLEEHQS