A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPM2. Source: E.coli Amino Acid Sequence: IKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQK The TRPM2 Recombinant Protein Antigen is derived from E. coli. The TRPM2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Gene ID (Entrez) : 7226
Méthode de purification : >80% by SDS-PAGE and Coomassie blue staining
Nom usuel : TRPM2 Recombinant Protein Antigen
Contenu et stockage : Store at −20C. Avoid freeze-thaw cycles.
Formule : PBS and 1M Urea, pH 7.4.
À utiliser avec (application) : Blocking/Neutralizing, Control
Alias de gène : EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient r
Symbole de gène(s) : TRPM2
Type d’étiquette : Unlabeled
Type de produit : Recombinant Protein Antigen
Quantité : 100μL
État réglementaire : RUO
Source : E.Coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51204. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
