A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRPM2. Source: E.coli Amino Acid Sequence: IKKMLEVLVVKLPLSEHWALPGGSREPGEMLPRKLKRILRQEHWPSFENLLKCGMEVYKGYMDDPRNTDNAWIETVAVSVHFQDQNDVELNRLNSNLHACDSGASIRWQVVDRRIPLYANHKTLLQK The TRPM2 Recombinant Protein Antigen is derived from E. coli. The TRPM2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
- Gene ID (Entrez)
- 7226
- Méthode de purification
- >80% by SDS-PAGE and Coomassie blue staining
- Nom usuel
- TRPM2 Recombinant Protein Antigen
- Contenu et stockage
- Store at −20C. Avoid freeze-thaw cycles.
- Formule
- PBS and 1M Urea, pH 7.4.
- À utiliser avec (application)
- Blocking/Neutralizing, Control
- Alias de gène
- EC 3.6.1.13, EREG1MGC133383, Estrogen-responsive element-associated gene 1 protein, KNP3LTrpC-2, Long transient receptor potential channel 2, LTrpC2, LTRPC2TRPC7transient receptor potential cation channel subfamily M member 2, NUDT9H, NUDT9L1, transient r
- Symbole de gène(s)
- TRPM2
- Type d’étiquette
- Unlabeled
- Type de produit
- Recombinant Protein Antigen
- Quantité
- 100μL
- État réglementaire
- RUO
- Source
- E.Coli
- Réactivité spécifique
- This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51204. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
