Novus Biologicals™ LYRM5 Recombinant Protein Antigen

Ref : 18122860
233.26

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Gene ID (Entrez) :
144363
Espèces :
Human
Méthode de purification :
Chromatography
Pureté :
>80%
Concentration :
0.5mg/mL
Contenu et stockage :
Store at -20°C. Avoid freeze-thaw cycles.
Brand
Novus Biologicals™
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LYRM5. The LYRM5 Recombinant Protein Antigen is derived from E. coli. The LYRM5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-92091. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Gene ID (Entrez) : 144363

Espèces : Human

Méthode de purification : Chromatography

Pureté : >80%

Concentration : 0.5mg/mL

Contenu et stockage : Store at -20°C. Avoid freeze-thaw cycles.

Formule : PBS and 1M Urea, pH 7.4.

À utiliser avec (application) : Blocking/Neutralizing, Control

Symbole de gène(s) : LYRM5

Type d’étiquette : Unlabeled

Poids moléculaire : 27kDa

Type de produit : LYRM5

Quantité : 0.1mL

État réglementaire : RUO

Source : E.Coli

Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92091. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

Immunogène : LRGEVLKLYKNLLYLGRDYPKGADYFKKRLKNIFLKNKDVKNPEKIKELIAQGEFVMKELEALYFLRKYRAMKQRYYSDTN

Similar items
Thermo Scientific™ HA Synthetic Peptide 294.00
Thermo Scientific Chemicals MG 132
Thermo Scientific Chemicals Gly-Phe-Arg 65.70
Thermo Scientific Chemicals Necrostatin-1, Inactive Control 96.70