A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMIM22. Source: E.coli Amino Acid Sequence: VSTEELEATVQEVLGRLKSHQFFQSTWDTV The SMIM22 Recombinant Protein Antigen is derived from E. coli. The SMIM22 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Gene ID (Entrez) : 440335
Méthode de purification : >80% by SDS-PAGE and Coomassie blue staining
Nom usuel : SMIM22 Recombinant Protein Antigen
Contenu et stockage : Store at −20°C. Avoid freeze-thaw cycles
Formule : PBS and 1M Urea, pH 7.4
À utiliser avec (application) : Blocking/Neutralizing, Control
Alias de gène : Small Integral Membrane Protein 22
Symbole de gène(s) : SMIM22
Type d’étiquette : Unlabeled
Type de produit : Recombinant Protein Antigen
Quantité : 100μL
État réglementaire : RUO
Source : E.coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53605. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
