A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF292. Source: E.coli Amino Acid Sequence: NSLGTPSVPPKAPVQKFSCQVEGCTRTYNSSQSIGKHMKTAHPDQYAAFKMQRKSKKGQKANNLNTPNNGKFVYFLPSPVNSSNPFFTSQTKANGNPAC The ZNF292 Recombinant Protein Antigen is derived from E. coli. The ZNF292 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Gene ID (Entrez) : 23036
Méthode de purification : >80% by SDS-PAGE and Coomassie blue staining
Nom usuel : ZNF292 Recombinant Protein Antigen
Contenu et stockage : Store at −20°C. Avoid freeze-thaw cycles
Formule : PBS and 1M Urea, pH 7.4
À utiliser avec (application) : Blocking/Neutralizing, Control
Alias de gène : bA393I2.3, FLJ13564, FLJ41479, KIAA0530, zinc finger protein 292
Symbole de gène(s) : ZNF292
Type d’étiquette : Unlabeled
Type de produit : Recombinant Protein Antigen
Quantité : 100μL
État réglementaire : RUO
Source : E.coli
Réactivité spécifique : This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51684. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
