Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Adenosine A1 R.
E.coli
NNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFN The Adenosine A1R Recombinant Protein Antigen is derived from E. coli. The Adenosine A1R Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-043982 |
| Réf. fabricant | 18222551 |
| Gene ID (Entrez) | 134 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | Adenosine A1R |
| Contenu et stockage | Store at −20C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | adenosine A1 receptor, ADORA 1, RDC7adenosine receptor A1 |
| Symbole de gène(s) | ADORA1 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51447. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
