A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S-arrestin.
Points forts
Amino Acid Sequence
EPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKS The S-arrestin Recombinant Protein Antigen is derived from E. coli. The S-arrestin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-044191 |
|---|
| Réf. fabricant | 18205694 |
|---|
| Gene ID (Entrez) | 6295 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | S-arrestin Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles |
|---|
| Formule | PBS and 1M Urea, pH 7.4 |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | arrestin 1, RP47,48 kDa protein, S-antigen; retina and pineal gland (arrestin), S-arrestin, visual arrestin |
|---|
| Symbole de gène(s) | SAG |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Catégorie de recherche | Cell Biology, Cellular Markers, Neuroscience, Neurotransmission, Sensory Systems, Signal Transduction, Vision |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51047. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
