Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Citron.
E.coli
ERSDLEYQLENIQVLYSHEKVKMEGTISQQTKLIDFLQAKMDQPAKKKKGLFSRRKEDPALPTQVPLQYNELKLALEKEKARCA The Citron Kinase Recombinant Protein Antigen is derived from E. coli. The Citron Kinase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-044984 |
| Réf. fabricant | 18209981 |
| Gene ID (Entrez) | 11113 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | Citron Kinase |
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles |
| Formule | PBS and 1M Urea, pH 7.4 |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | CITK, citron (rho-interacting, serine/threonine kinase 21), Citron Rho-Interacting Kinase, Citron Rho-Interacting Serine/Threonine Kinase, CRIK, KIAA0949, MCPH17, Rho-interacting Serine/Threonine kinase 21, serine/threonine kinase 21, Serine/threonine-protein kinase 21, STK21 |
| Symbole de gène(s) | CIT |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53538. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
