A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cbl-c.
Points forts
Amino Acid Sequence
GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL The Cbl-c Recombinant Protein Antigen is derived from E. coli. The Cbl-c Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-046246 |
|---|
| Réf. fabricant | 18220753 |
|---|
| Gene ID (Entrez) | 23624 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | Cbl-c Recombinant Protein Antigen |
|---|
| Contenu et stockage | −20°C, avoid freeze-thaw cycles |
|---|
| Formule | PBS and 1M Urea, pH 7.4 |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | Cas-Br-M (murine) ecotropic retroviral transforming sequence c, Cas-Br-M (murine) ectropic retroviral transforming sequence c, CBL3, CBL-3, CBL-SL, RING finger protein 57, RNF57SH3-binding protein CBL-3, SH3-binding protein CBL-C, signal transduction prot |
|---|
| Symbole de gène(s) | CBLC |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51267. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
