A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nucleoporin NUP85/Pericentrin 1.
Points forts
Amino Acid Sequence
ENPSKHDSFWNLVTILVLQGRLDEARQMLSKEADASPASAGICRIMGDLMRTMPILSPGNTQTLTELELKWQ The Nucleoporin NUP85/Pericentrin 1 Recombinant Protein Antigen is derived from E. coli. The Nucleoporin NUP85/Pericentrin 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-046288 |
|---|
| Réf. fabricant | 18278012 |
|---|
| Gene ID (Entrez) | 79902 |
|---|
| Famille de protéines | Nucleoporin NUP85 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | Nucleoporin NUP85/Pericentrin 1 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | 85 kDa nucleoporin, FLJ12549, frount, nuclear pore complex protein Nup85, nucleoporin 85kDa, Nucleoporin Nup75, Nucleoporin Nup85, Nup75, PCNT, PCNT1, Pericentrin-1 |
|---|
| Symbole de gène(s) | NUP85 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50512. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
| Gène cible | Os01g0847700 protein |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
