Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPA2B1. The hnRNP A2B1 Recombinant Protein Antigen is derived from E. coli. The hnRNP A2B1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-89675. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-047068 |
| Réf. fabricant | 18261499 |
| Gene ID (Entrez) | 3181 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | DKFZp779B0244, FLJ22720, heterogeneous nuclear ribonucleoprotein A2/B1, heterogeneous nuclear ribonucleoprotein B1, heterogeneous nuclear ribonucleoproteins A2/B1, hnRNP A2 hnRNP B1, HNRNPA2, HNRNPB1, HNRPA2, HNRPA2B1hnRNP A2/B1, HNRPB1, nuclear ribonucleoprotein particle A2 protein, RNPA2, SNRPB1 |
| Symbole de gène(s) | HNRNPA2B1 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 33kDa |
| Type de produit | hnRNP A2B1 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89675. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL |
