Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DIS3.
E.coli
LSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDSANMNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEV The DIS3 Recombinant Protein Antigen is derived from E. coli. The DIS3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-048193 |
| Réf. fabricant | 18272353 |
| Gene ID (Entrez) | 22894 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | DIS3 Recombinant Protein Antigen |
| Contenu et stockage | −20°C, avoid freeze-thaw cycles |
| Formule | PBS and 1M Urea, pH 7.4 |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | 2810028N01Rik, DIS3 mitotic control homolog (S. cerevisiae), dis3p, DKFZp667L1817, EC 3.1.13, EC 3.1.13.-, EC 3.1.26.-, EXOSC11, exosome complex exonuclease RRP44, exosome component 11, FLJ10484, KIAA1008RP11-342J4.3, MGC33035, mitotic control protein dis |
| Symbole de gène(s) | DIS3 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52298. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
