A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HADHA.
Points forts
Amino Acid Sequence
DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK The HADHA Recombinant Protein Antigen is derived from E. coli. The HADHA Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-048910 |
|---|
| Réf. fabricant | 18243174 |
|---|
| Pureté | Greater than 80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | HADHA Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|
| À utiliser avec (application) | Antibody Competition |
|---|
| Poids moléculaire | 28 kDa |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100 uL |
|---|
| Séquence | DEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKK |
|---|
| Source | E. coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50314. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
