Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CES1. The Carboxylesterase 1/CES1 Recombinant Protein Antigen is derived from E. coli. The Carboxylesterase 1/CES1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-85691. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-049076 |
| Réf. fabricant | 18363731 |
| Gene ID (Entrez) | 1066 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Nom usuel | Carboxylesterase 1/CES1 |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | ACAT, acyl coenzyme A:cholesterol acyltransferase, Acyl-coenzyme A:cholesterol acyltransferase, Brain carboxylesterase hBr1, carboxylesterase 1, carboxylesterase 1 (monocyte/macrophage serine esterase 1), carboxylesterase 2 (liver), CEH, Ces-1, CES1A2, CES2EC 3.1.1.1, cholesteryl ester hydrolase, Cocaine carboxylesterase, EC 3.1.1, egasyn, HMSE1, HMSECES1A1, human monocyte/macrophage serine esterase 1, liver carboxylesterase 1, MGC117365, Monocyte/macrophage serine esterase, PCE-1, REH, Retinyl ester hydrolase, Serine esterase 1, Ses-1, SES1TGH, Triacylglycerol hydrolase |
| Symbole de gène(s) | CES1 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 32kDa |
| Type de produit | CES1 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85691. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVP |
