A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-12 R beta 1.
Points forts
Amino Acid Sequence
TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES The IL-12 R beta 1 Recombinant Protein Antigen is derived from E. coli. The IL-12 R beta 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-049620 |
|---|
| Réf. fabricant | 18222333 |
|---|
| Gene ID (Entrez) | 3594 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | IL-12 R beta 1 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | CD212, CD212 antigen, IL-12 receptor beta component, IL-12 receptor subunit beta-1, IL12R, IL-12R subunit beta-1, IL12RB, IL-12RB1, IL-12R-beta-1, IL-12R-BETA1, interleukin 12 receptor, beta 1, interleukin-12 receptor beta-1 chain, interleukin-12 receptor |
|---|
| Symbole de gène(s) | IL12RB1 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53484. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
