"/> Novus Biologicals™ Antigène protéique recombinant… | B-LABO France

Novus Biologicals™ Antigène protéique recombinant Met-enkephalin

Name: Novus Biologicals™ Antigène protéique recombinant Met-enkephalin
Brand: Novus Biologicals
SKU: 18778043
Price: 242.97 EUR
Availability: InStock

Réf. : BL-RE-050297Réf. fabricant : 18778043

242,97 € HT

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Espèces: Human
Méthode de purification: Chromatography
Symbole de gène(s): PENK
Type d’étiquette: Unlabeled
Immunogène: ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEE
Marque: Novus Biologicals

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PENK. The Met-enkephalin Recombinant Protein Antigen is derived from E. coli. The Met-enkephalin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-90944. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Caractéristiques techniques

Marque	Novus Biologicals
Réf. B-LABO	BL-RE-050297
Réf. fabricant	18778043
Espèces	Human
Méthode de purification	Chromatography
Symbole de gène(s)	PENK
Type d’étiquette	Unlabeled
Immunogène	ECSQDCATCSYRLVRPADINFLACVMECEGKLPSLKIWETCKELLQLSKPELPQDGTSTLRENSKPEESHLLAKRYGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEE

Une question, une configuration particulière ?
Contactez-nous pour un devis.

Demander un devis 03 65 67 15 79

Novus Biologicals™ Antigène protéique recombinant Met-enkephalin

Caractéristiques techniques

Produits similaires

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set

Novus Biologicals™ Antigène protéique recombinant HB-EGF

Novus Biologicals™ Antigène protéique recombinant ODF2L

Novus Biologicals™ Antigène protéique recombinant UBE2R1/CDC34