Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD34. The CD34 Recombinant Protein Antigen is derived from E. coli. The CD34 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP2-38321. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-050425 |
| Réf. fabricant | 18115978 |
| Gene ID (Entrez) | 947 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Symbole de gène(s) | CD34 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 25kDa |
| Type de produit | CD34 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Catégorie de recherche | Adaptive Immunity, Angiogenesis, B Cell Development and Differentiation Markers, Breast Cancer, Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Hematopoietic Stem Cell Markers, Hypoxia, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Myeloid Cell Markers, Myeloid derived Suppressor Cell, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Tumor Suppressors |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38321. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | ATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAG |
