A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGF-12.
Points forts
Amino Acid Sequence
EPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDS The FGF-12 Recombinant Protein Antigen is derived from E. coli. The FGF-12 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-050998 |
|---|
| Réf. fabricant | 18268991 |
|---|
| Gene ID (Entrez) | 2257 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | FGF-12 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | FGF-12, FGF12B, FHF-1, FHF1Fibroblast growth factor homologous factor 1, fibroblast growth factor 12, fibroblast growth factor 12B, fibroblast growth factor FGF-12b, Myocyte-activating factor |
|---|
| Symbole de gène(s) | FGF12 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53297. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
