Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Colec12.
E.coli
GYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQ The Colec12 Recombinant Protein Antigen is derived from E. coli. The Colec12 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-053474 |
| Réf. fabricant | 18273874 |
| Gene ID (Entrez) | 81035 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | CL-P1/COLEC12 |
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | CL-P1, CLP1hCL-P1, collectin placenta 1, Collectin placenta protein 1, collectin sub-family member 12, collectin-12, Nurse cell scavenger receptor 2, SCARA4NSR2, Scavenger receptor class A member 4, scavenger receptor class A, member 4, SRCLScavenger rece |
| Symbole de gène(s) | COLEC12 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50846. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
