A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mover.
Points forts
Amino Acid Sequence
PLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQGVWLLTEVDHWNNEK The Mover Recombinant Protein Antigen is derived from E. coli. The Mover Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-053542 |
|---|
| Réf. fabricant | 18251045 |
|---|
| Gene ID (Entrez) | 127262 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | Mover Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | FAM79A, family with sequence similarity 79, member A, FLJ21811, h-mover, Mossy fiber terminal-associated vertebrate-specific presynaptic protein, MOVER, Protein FAM79A, RP11-46F15.3, tumor protein p63 regulated 1-like, tumor protein p63-regulated gene 1-l |
|---|
| Symbole de gène(s) | TPRG1L |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.Coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52648. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
