A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MERIT40/HSPC142.
Points forts
Amino Acid Sequence
EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL The MERIT40/HSPC142 Recombinant Protein Antigen is derived from E. coli. The MERIT40/HSPC142 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-053919 |
|---|
| Réf. fabricant | 18231981 |
|---|
| Gene ID (Entrez) | 29086 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | MERIT40/HSPC142 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | BRISC and BRCA1 A complex member 1, C10orf62, C19orf62, chromosome 19 open reading frame 62, FLJ20571, HSPC142, mediator of Rap80 interactions and targeting 40 kDa, Mediator of RAP80 interactions and targeting subunit of 40 kDa, MERIT40BRCA1-A complex sub |
|---|
| Symbole de gène(s) | BABAM1 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Catégorie de recherche | DNA replication Transcription Translation and Splicing |
|---|
| Source | E.Coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50277. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
