Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human B3GNT3. The B3GNT3 Recombinant Protein Antigen is derived from E. coli. The B3GNT3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-88953. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-054019 |
| Réf. fabricant | 18309270 |
| Gene ID (Entrez) | 10331 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | b3Gal-T8, B3GALT8, B3GN-T3, B3GNT-3, Beta-1,3-galactosyltransferase 8, Beta-1,3-GalTase 8, beta-1,3-Gn-T3, Beta-1,3-N-acetylglucosaminyltransferase 3, beta-1,3-N-acetylglucosaminyltransferase bGnT-3, beta3GalT8, Beta3Gal-T8, beta3Gn-T3, beta-3-Gx-T8, BGnT-3, Core 1 extending beta-1,3-N-acetylglucosaminyltransferase, Core1-beta3GlcNAcT, EC 2.4.1, EC 2.4.1.-, HP10328, putative type II membrane protein, TMEM3beta3Gal-T8, transmembrane protein 3, UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 8, UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 8, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 |
| Symbole de gène(s) | B3GNT3 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 34kDa |
| Type de produit | B3GNT3 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88953. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | LLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYLQDHDPGRHLFV |
