Novus Biologicals™ Antigène protéique recombinant 53BP1
242,97 € HT
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
- Gene ID (Entrez)
- 7158
- Longueur des protéines
- AYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEAL
- Méthode de purification
- >80% by SDS-PAGE and Coomassie blue staining
- Nom usuel
- 53BP1 Recombinant Protein Antigen
- Contenu et stockage
- Store at −20°C. Avoid freeze-thaw cycles.
- Marque
- Novus Biologicals
