Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CBX4.
E.coli
SPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTDNRAKLDSGAEEK The CBX4 Recombinant Protein Antigen is derived from E. coli. The CBX4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-083220 |
| Réf. fabricant | 18204485 |
| Gene ID (Entrez) | 8535 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | CBX4 Recombinant Protein Antigen |
| Contenu et stockage | −20°C, avoid freeze-thaw cycles |
| Formule | PBS and 1M Urea, pH 7.4 |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | chromobox homolog 4, chromobox homolog 4 (Drosophila Pc class), Chromobox protein homolog 4, Drosophila), E3 SUMO-protein ligase CBX4, hPC2, NS5ATP1-binding protein 16, Pc class 2 homolog, PC2, Polycomb 2 homolog |
| Symbole de gène(s) | CBX4 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51074. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
