Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PSMB7.
E.coli
LVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTM The PSMB7 Recombinant Protein Antigen is derived from E. coli. The PSMB7 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-083223 |
| Réf. fabricant | 18230135 |
| Gene ID (Entrez) | 5695 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | Proteasome 20S beta 7 |
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | EC 3.4.25.1, Macropain chain Z, Multicatalytic endopeptidase complex chain Z, proteasome (prosome, macropain) subunit, beta type, 7, proteasome subunit alpha, proteasome subunit beta 7, proteasome subunit beta type-7, Proteasome subunit Z, PSMB7, Zproteasome catalytic subunit 2 |
| Symbole de gène(s) | PSMB7 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50286. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
