A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human beta-1,4-Galactosyltransferase 2/B4GalT2.
Points forts
Amino Acid Sequence
PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV The beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein Antigen is derived from E. coli. The beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-083986 |
|---|
| Réf. fabricant | 18218242 |
|---|
| Gene ID (Entrez) | 8704 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | beta-1,4-Galactosyltransferase 2/B4GalT2 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | B4Gal-T2, B4Gal-T3, beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2, beta-4-GalT2, beta4Gal-T2, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2, UDP-Gal:betaGlcNA |
|---|
| Symbole de gène(s) | B4GALT2 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51060. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
