A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Beta 2 Adaptin.
Points forts
Amino Acid Sequence
GGLDSLVGQSFIPSSVPATFAPSPTPAVVSSGLNDLFELSTGIGMAPGGYVAPKA The Beta 2 Adaptin Recombinant Protein Antigen is derived from E. coli. The Beta 2 Adaptin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-084190 |
|---|
| Réf. fabricant | 18259282 |
|---|
| Gene ID (Entrez) | 163 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | Beta 2 Adaptin Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, adaptor-related protein complex 2, beta 1 subunit, ADTB2adaptin, beta 2 (beta), AP105B, AP2-BETA, Beta-2-adaptin, Beta-adaptin, CLAPB1AP-2 complex subunit beta, Cla |
|---|
| Symbole de gène(s) | AP2B1 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.Coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52119. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
