Highly potent GIP agonist
[D-Ala2]-GIP (human) is a highly potent GIP receptor agonist (EC50 = 630 ± 119 pM). Displays equivalent cAMP stimulating properties and improved resistance to enzymatic degradation compared to native GIP (Cat. No. 2084) in cells expressing wild type GIP receptor. Improves glucose tolerance, insulin release and cognitive function in various animal models of obesity and diabetes. Displays neuroprotective effects in an MPTP model of PD.
| Marque | Tocris |
|---|---|
| Réf. B-LABO | BL-RE-084275 |
| Réf. fabricant | 18796556 |
| Pureté | 95% |
| CAS | 444073-04-5 |
| Contenu et stockage | Store at -20°C |
| Formule | C<sub>226</sub>H<sub>338</sub>N<sub>60</sub>O<sub>66</sub>S |
| Poids moléculaire | 4983.58 |
| Quantité | 1 mg |
| Séquence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ (Modifications: Ala-2 = D-Ala) |
