Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COP9.
E.coli
LRGIGILKQAIDKMQMNTNQLTSIHADLCQLCLLAKCFKPALPYLDVDMMDICKENGAYDAKHFLCYYYYGGMIYTGLKNFERALYFYEQAITTPAM The COP9 Recombinant Protein Antigen is derived from E. coli. The COP9 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-084304 |
| Réf. fabricant | 18272563 |
| Gene ID (Entrez) | 8533 |
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
| Nom usuel | COP9 Recombinant Protein Antigen |
| Contenu et stockage | −20°C, avoid freeze-thaw cycles |
| Formule | PBS and 1M Urea, pH 7.4 |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | COP9 constitutive photomorphogenic homolog subunit 3 (Arabidopsis), COP9 signalosome complex subunit 3, CSN3COP9 complex subunit 3, JAB1-containing signalosome subunit 3, SGN3COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 3, Signalosom |
| Symbole de gène(s) | COPS3 |
| Type d’étiquette | Unlabeled |
| Type de produit | Recombinant Protein Antigen |
| Quantité | 100μL |
| État réglementaire | RUO |
| Source | E.coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50181. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
