Novus Biologicals™ Peptide bloquant d’anticorps Glycerol Kinase

Name: Novus Biologicals™ Peptide bloquant d’anticorps Glycerol Kinase
Brand: Novus Biologicals
SKU: 18247772
Price: 192.22 EUR
Availability: InStock

Réf. : BL-RE-084817Réf. fabricant : 18247772 100 μg

192,22 € HT

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Gene ID (Entrez): 2710
Espèces: Human
Contenu et stockage: Store at -20 C. Avoid freeze-thaw cycles.
Formule: Lyophilized with sterile distilled water.
À utiliser avec (application): This Peptide is Useful as a Blocking Peptide for NBP1-57033. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Marque: Novus Biologicals

Points forts

Source

Synthetic

Amino Acid Sequence

(Accession #: NP_976325)MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS The Glycerol Kinase Blocking Peptide is derived from Synthetic. The Glycerol Kinase Blocking Peptide has been validated for the following applications: Antibody Competition.

Caractéristiques techniques

Marque	Novus Biologicals
Réf. B-LABO	BL-RE-084817
Réf. fabricant	18247772
Gene ID (Entrez)	2710
Espèces	Human
Contenu et stockage	Store at -20 C. Avoid freeze-thaw cycles.
Formule	Lyophilized with sterile distilled water.
À utiliser avec (application)	This Peptide is Useful as a Blocking Peptide for NBP1-57033. This Synthetic Peptide is Designed for Use in an Antibody Competition Assay with Its Corresponding Antibody. Use of This Product in Any Other Assay Has Not Yet Been Tested. For Further Blocking Peptide Related Protocol, Click Here .
Alias de gène	ATP:glycerol 3-phosphotransferase, EC 2.7.1.30, GK1, GKD, Glycerokinase, glycerol kinase
Symbole de gène(s)	GK
Poids moléculaire	58kDa
Type de produit	Glycerol Kinase
Quantité	100 μg
État réglementaire	RUO - research use only