Novus Biologicals™ Antigène protéique recombinant RABL2A
242,97 € HT
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
- Longueur des protéines
- DKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATV
- Pureté
- >80% by SDS-PAGE and Coomassie blue staining
- Nom usuel
- RABL2A Recombinant Protein Antigen
- Contenu et stockage
- Store at −20°C. Avoid freeze-thaw cycles.
- Formule
- PBS and 1M Urea, pH 7.4
- Marque
- Novus Biologicals
