A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human S1P1/EDG-1.
Points forts
Amino Acid Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT The S1P1/EDG-1 Recombinant Protein Antigen is derived from E. coli. The S1P1/EDG-1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-085179 |
|---|
| Réf. fabricant | 18294903 |
|---|
| Gene ID (Entrez) | 1901 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | S1P1/EDG-1 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles |
|---|
| Formule | PBS and 1M Urea, pH 7.4 |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | CD363, CD363 antigen, CHEDG1, D1S3362, EDG-1, EDG1edg-1, Endothelial differentiation G-protein coupled receptor 1, endothelial differentiation, sphingolipid G-protein-coupled receptor, 1, FLJ58121, S1P receptor 1, S1P receptor Edg-1, s1p1, S1P1ECGF1, sphi |
|---|
| Symbole de gène(s) | S1PR1 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53543. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
