Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP6V0A2. The ATP6V0A2 Recombinant Protein Antigen is derived from E. coli. The ATP6V0A2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-91690. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-085278 |
| Réf. fabricant | 18021249 |
| Gene ID (Entrez) | 23545 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | A2, ARCL, ATP6a2, ATP6N1D, ATP6V0, ATPase, H+ transporting, lysosomal V0 subunit a isoform 2, ATPase, H+ transporting, lysosomal V0 subunit a2, infantile malignant osteopetrosis, J6B7, Lysosomal H(+)-transporting ATPase V0 subunit a2, regeneration and tolerance factor, RTF, STV1, TJ6A2V-ATPase, TJ6M, TJ6S, vacuolar proton translocating ATPase 116 kDa subunit a, Vacuolar proton translocating ATPase 116 kDa subunit a isoform 2, v-ATPase 116 kDa, V-ATPase 116 kDa isoform a2, Vph1, v-type proton ATPase 116 kDa subunit a, V-type proton ATPase 116 kDa subunit a isoform 2, WSS |
| Symbole de gène(s) | ATP6V0A2 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 33kDa |
| Type de produit | ATP6V0A2 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91690. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | EVKRCEELERILVYLVQEINRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKNLLELIEYTHMLRVTKTFVKRNVEFEPTYEEFPSLESDSLLDYSCMQRLGAKLGFVSGLINQGKVEAFE |
