Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAS. The Fas/TNFRSF6/CD95 Recombinant Protein Antigen is derived from E. coli. The Fas/TNFRSF6/CD95 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-89034. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-103910 |
| Réf. fabricant | 18343361 |
| Gene ID (Entrez) | 355 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | ALPS1A, Apo-1, APO-1 cell surface antigen, apoptosis antigen 1, apoptosis signaling receptor FAS, Apoptosis-mediating surface antigen FAS, APT1, CD95, CD95 antigen, Fas (TNF receptor superfamily, member 6), Fas AMA, FAS1, FASLG receptor, FASTM, mutant tumor necrosis receptor superfamily member 6, TNF receptor superfamily member 6, TNFRSF6, tumor necrosis factor receptor superfamily member 6, tumor necrosis factor receptor superfamily, member 6 |
| Symbole de gène(s) | FAS |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 25kDa |
| Type de produit | Fas/TNFRSF6/CD95 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Catégorie de recherche | Apoptosis, Cancer, Cell Biology, Death Receptor Signaling Pathway, Diabetes Research, Hematopoietic Stem Cell Markers, Immunology, Inhibitors Activators and Regulators, Innate Immunity, Signal Transduction, Stem Cells |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89034. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH |
