Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF4A3. The EIF4A3 Recombinant Protein Antigen is derived from E. coli. The EIF4A3 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
This is a blocking peptide for NBP1-85268. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
| Marque | Novus Biologicals |
|---|---|
| Réf. B-LABO | BL-RE-104101 |
| Réf. fabricant | 18257838 |
| Gene ID (Entrez) | 9775 |
| Espèces | Human |
| Méthode de purification | Chromatography |
| Pureté | >80% |
| Concentration | 0.5mg/mL |
| Contenu et stockage | Store at -20°C. Avoid freeze-thaw cycles. |
| Formule | PBS and 1M Urea, pH 7.4. |
| À utiliser avec (application) | Blocking/Neutralizing, Control |
| Alias de gène | ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DDX48, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, DKFZp686O16189, EC 3.6.1, EC 3.6.4.13, eIF4AIII, eIF-4A-III, eIF4A-III, eukaryotic initiation factor 4A-III, Eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation factor 4A, Eukaryotic translation initiation factor 4A isoform 3, eukaryotic translation initiation factor 4A3, hNMP 265, KIAA0111eukaryotic translation initiation factor 4A, isoform 3, MGC10862, NMP 265, NMP265, Nuclear matrix protein 265, NUK34 |
| Symbole de gène(s) | EIF4A3 |
| Type d’étiquette | Unlabeled |
| Poids moléculaire | 26kDa |
| Type de produit | EIF4A3 |
| Quantité | 0.1mL |
| État réglementaire | RUO |
| Catégorie de recherche | Signal Transduction |
| Source | E.Coli |
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85268. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Immunogène | MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK |
