A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC6A16.
Points forts
Amino Acid Sequence
SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP The SLC6A16 Recombinant Protein Antigen is derived from E. coli. The SLC6A16 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Caractéristiques techniques
| Marque | Novus Biologicals |
|---|
| Réf. B-LABO | BL-RE-143112 |
|---|
| Réf. fabricant | 18298501 |
|---|
| Gene ID (Entrez) | 28968 |
|---|
| Méthode de purification | >80% by SDS-PAGE and Coomassie blue staining |
|---|
| Nom usuel | SLC6A16 Recombinant Protein Antigen |
|---|
| Contenu et stockage | Store at −20°C. Avoid freeze-thaw cycles. |
|---|
| Formule | PBS and 1M Urea, pH 7.4. |
|---|
| À utiliser avec (application) | Blocking/Neutralizing, Control |
|---|
| Alias de gène | NTT5solute carrier family 6 (neurotransmitter transporter), member 16, orphan sodium- and chloride-dependent neurotransmitter transporter NTT5, Solute carrier family 6 member 16, solute carrier family 6, member 16 |
|---|
| Symbole de gène(s) | SLC6A16 |
|---|
| Type d’étiquette | Unlabeled |
|---|
| Type de produit | Recombinant Protein Antigen |
|---|
| Quantité | 100μL |
|---|
| État réglementaire | RUO |
|---|
| Source | E.coli |
|---|
| Réactivité spécifique | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53592. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
|---|
Une question, une configuration particulière ?
Contactez-nous pour un devis.
