A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPP14. Source: E.coli Amino Acid Sequence: VHGVLINGLISALLGTKMPGPGCVFLSQEISFPAPLYIGEVVLASAEVKKL The RPP14 Recombinant Protein Antigen is derived from E. coli. The RPP14 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
- Gene ID (Entrez)
- 11102
- Méthode de purification
- >80% by SDS-PAGE and Coomassie blue staining
- Nom usuel
- RPP14 Recombinant Protein Antigen
- Contenu et stockage
- Store at −20°C. Avoid freeze-thaw cycles
- Formule
- PBS and 1M Urea, pH 7.4
- À utiliser avec (application)
- Blocking/Neutralizing, Control
- Alias de gène
- EC 3.1.26.5, EC 4.2.1.-, FLJ31508, HsHTD2, P14,3-hydroxyacyl-[acyl-carrier-protein] dehydratase, ribonuclease P (14kD), ribonuclease P 14kDa subunit, ribonuclease P protein subunit p14, ribonuclease P/MRP 14kDa subunit
- Symbole de gène(s)
- RPP14
- Type d’étiquette
- Unlabeled
- Type de produit
- Recombinant Protein Antigen
- Quantité
- 100μL
- État réglementaire
- RUO
- Source
- E.coli
- Réactivité spécifique
- This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52970. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
